SHP1 (PTPN6) (NM_080548) Human Mass Spec Standard
CAT#: PH300728
PTPN6 MS Standard C13 and N15-labeled recombinant protein (NP_536858)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200728 |
Predicted MW | 67.7 kDa |
Protein Sequence |
>RC200728 protein sequence
Red=Cloning site Green=Tags(s) MLSRGWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDFYDLYGGEK FATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQAETLLQAKGEPWTFLVRES LSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIEEASGAFVY LRQPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKN ILPFDHSRVILQGRDSNIPGSDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIV MTTREVEKGRNKCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWP DHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTI QMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSK HKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_536858 |
RefSeq Size | 2234 |
RefSeq ORF | 1791 |
Synonyms | HCP; HCPH; HPTP1C; PTP-1C; SH-PTP1; SHP-1; SHP-1L; SHP1 |
Locus ID | 5777 |
UniProt ID | P29350, Q53XS4 |
Cytogenetics | 12p13.31 |
Summary | 'The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. N-terminal part of this PTP contains two tandem Src homolog (SH2) domains, which act as protein phospho-tyrosine binding domains, and mediate the interaction of this PTP with its substrates. This PTP is expressed primarily in hematopoietic cells, and functions as an important regulator of multiple signaling pathways in hematopoietic cells. This PTP has been shown to interact with, and dephosphorylate a wide spectrum of phospho-proteins involved in hematopoietic cell signaling. Multiple alternatively spliced variants of this gene, which encode distinct isoforms, have been reported. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Phosphatase, Stem cell - Pluripotency |
Protein Pathways | Adherens junction, B cell receptor signaling pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401007 | PTPN6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC409133 | PTPN6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401007 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 1 |
USD 396.00 |
|
LY409133 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 2 |
USD 396.00 |
|
PH313896 | PTPN6 MS Standard C13 and N15-labeled recombinant protein (NP_002822) |
USD 2,055.00 |
|
TP300728 | Recombinant protein of human protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 2 |
USD 823.00 |
|
TP313896 | Recombinant protein of human protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 1 |
USD 748.00 |
|
TP720146 | Recombinant protein of human protein tyrosine phosphatase, non-receptor type 6 (PTPN6), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review