HMGB2 (NM_002129) Human Mass Spec Standard

CAT#: PH300750

HMGB2 MS Standard C13 and N15-labeled recombinant protein (NP_002120)

Product Images

Coomassie blue staining of purified HMGB2 protein (Cat# TP300750). The protein was produced from HEK293T cells transfected with HMGB2 cDNA clone (Cat# RC200750) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200750
• Predicted MW: 24 kDa
• Protein Sequence:
  Sequence Link

  >RC200750 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKAR
  YDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKD
  KQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002120
• RefSeq Size: 1527
• RefSeq ORF: 627
• Synonyms: HMG2
• Locus ID: 3148
• UniProt ID: P26583
• Cytogenetics: 4q34.1
• Summary: 'This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transcription Factors