C3orf10 (BRK1) (NM_018462) Human Mass Spec Standard
CAT#: PH300804
C3orf10 MS Standard C13 and N15-labeled recombinant protein (NP_060932)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200804 |
Predicted MW | 8.7 kDa |
Protein Sequence |
>RC200804 protein sequence
Red=Cloning site Green=Tags(s) MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK GETLT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_060932 |
RefSeq Size | 1197 |
RefSeq ORF | 225 |
Synonyms | C3orf10; hHBrk1; HSPC300; MDS027 |
Locus ID | 55845 |
UniProt ID | Q8WUW1 |
Cytogenetics | 3p25.3 |
Protein Pathways | Regulation of actin cytoskeleton |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413040 | BRK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413040 | Transient overexpression lysate of chromosome 3 open reading frame 10 (C3orf10) |
USD 396.00 |
|
TP300804 | Recombinant protein of human chromosome 3 open reading frame 10 (C3orf10) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review