HAGHL (NM_032304) Human Mass Spec Standard

CAT#: PH300832

HAGHL MS Standard C13 and N15-labeled recombinant protein (NP_115680)

Product Images

Coomassie blue staining of purified HAGHL protein (Cat# TP300832). The protein was produced from HEK293T cells transfected with HAGHL cDNA clone (Cat# RC200832) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200832
• Predicted MW: 31.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200832 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLR
  PGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAG
  CGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKKRDEDDVPTV
  PSTLGEERLYNPFLRVAEEPVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAAP
  HD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115680
• RefSeq Size: 1386
• RefSeq ORF: 846
• Synonyms: MGC2605
• Locus ID: 84264
• UniProt ID: Q6PII5, B4DED4
• Cytogenetics: 16p13.3
• Summary: Hydrolase acting on ester bonds. [UniProtKB/Swiss-Prot Function]
• Protein Pathways: Pyruvate metabolism