HAGHL (NM_032304) Human Mass Spec Standard
CAT#: PH300832
HAGHL MS Standard C13 and N15-labeled recombinant protein (NP_115680)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200832 |
Predicted MW | 31.2 kDa |
Protein Sequence |
>RC200832 protein sequence
Red=Cloning site Green=Tags(s) MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLR PGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAG CGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKKRDEDDVPTV PSTLGEERLYNPFLRVAEEPVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAAP HD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115680 |
RefSeq Size | 1386 |
RefSeq ORF | 846 |
Synonyms | MGC2605 |
Locus ID | 84264 |
UniProt ID | Q6PII5, B4DED4 |
Cytogenetics | 16p13.3 |
Summary | Hydrolase acting on ester bonds. [UniProtKB/Swiss-Prot Function] |
Protein Pathways | Pyruvate metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404116 | HAGHL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC410246 | HAGHL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404116 | Transient overexpression lysate of hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 1 |
USD 396.00 |
|
LY410246 | Transient overexpression lysate of hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 2 |
USD 396.00 |
|
TP300832 | Recombinant protein of human hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 2 |
USD 823.00 |
|
TP761798 | Purified recombinant protein of Human hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review