HINFP (NM_015517) Human Mass Spec Standard

CAT#: PH300864

HINFP MS Standard C13 and N15-labeled recombinant protein (NP_056332)

Product Images

Coomassie blue staining of purified HINFP protein (Cat# TP300864). The protein was produced from HEK293T cells transfected with HINFP cDNA clone (Cat# RC200864) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200864
• Predicted MW: 59.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200864 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPPGKVPRKENLWLQCEWGSCSFVCSTMEKFFEHVTQHLQQHLHGSGEEEEEEEEDDPLEEEFSCLWQE
  CGFCSLDSSADLIRHVYFHCYHTKLKQWGLQALQSQADLGPCILDFQSRNVIPDIPDHFLCLWEHCENSF
  DNPEWFYRHVEAHSLCCEYEAVGKDNPVVLCGWKGCTCTFKDRSKLREHLRSHTQEKVVACPTCGGMFAN
  NTKFLDHIRRQTSLDQQHFQCSHCSKRFATERLLRDHMRNHVNHYKCPLCDMTCPLPSSLRNHMRFRHSE
  DRPFKCDCCDYSCKNLIDLQKHLDTHSEEPAYRCDFENCTFSARSLCSIKSHYRKVHEGDSEPRYKCHVC
  DKCFTRGNNLTVHLRKKHQFKWPSGHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLN
  ESSLQGIILETVPGEPGRKEEEEEGKGSEGTALSASQDNPSSVIHVVNQTNAQGQQEIVYYVLSEAPGEP
  PPVPEPPSGGIMEKLQGIAEEPEIQMV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056332
• RefSeq Size: 2374
• RefSeq ORF: 1551
• Synonyms: HiNF-P; MIZF; ZNF743
• Locus ID: 25988
• UniProt ID: Q9BQA5, A0A024R3F5
• Cytogenetics: 11q23.3
• Summary: This gene encodes a transcription factor that interacts with methyl-CpG-binding protein-2 (MBD2), a component of the MeCP1 histone deacetylase (HDAC) complex, and plays a role in DNA methylation and transcription repression. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2011]
• Protein Families: Transcription Factors