CCDC124 (NM_138442) Human Mass Spec Standard
CAT#: PH300867
CCDC124 MS Standard C13 and N15-labeled recombinant protein (NP_612451)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200867 |
Predicted MW | 25.8 kDa |
Protein Sequence |
>RC200867 protein sequence
Red=Cloning site Green=Tags(s) MPKKFQGENTKSAAARARRAEAKAAADAKKQKELEDAYWKDDDKHVMRKEQRKEEKEKRRLDQLERKKET QRLLEEEDSKLKGGKAPRVATSSKVTRAQIEDTLRRDHQLREAPDTAEKAKSHLEVPLEENVNRRVLEEG SVEARTIEDAIAVLSVAEEAADRHPERRMRAAFTAFEEAQLPRLKQENPNMRLSQLKQLLKKEWLRSPDN PMNQRAVPFNAPK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_612451 |
RefSeq Size | 1066 |
RefSeq ORF | 669 |
Synonyms | coiled-coil domain containing 124 |
Locus ID | 115098 |
UniProt ID | Q96CT7, A0A024R7M8 |
Cytogenetics | 19p13.11 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408696 | CCDC124 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427851 | CCDC124 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408696 | Transient overexpression lysate of coiled-coil domain containing 124 (CCDC124), transcript variant 1 |
USD 396.00 |
|
LY427851 | Transient overexpression lysate of coiled-coil domain containing 124 (CCDC124), transcript variant 2 |
USD 396.00 |
|
PH327128 | CCDC124 MS Standard C13 and N15-labeled recombinant protein (NP_001129675) |
USD 2,055.00 |
|
TP300867 | Recombinant protein of human coiled-coil domain containing 124 (CCDC124), transcript variant 1 |
USD 823.00 |
|
TP327128 | Recombinant protein of human coiled-coil domain containing 124 (CCDC124), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review