OTUD5 (NM_017602) Human Mass Spec Standard
CAT#: PH300893
OTUD5 MS Standard C13 and N15-labeled recombinant protein (NP_060072)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200893 |
Predicted MW | 60.4 kDa |
Protein Sequence |
>RC200893 representing NM_017602
Red=Cloning site Green=Tags(s) MTILPKKKPPPPDADPANEPPPPGPMPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGARPRASPPPQGP LPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAAAAGVGAAGVVVGVGGAVGVG GCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDK KGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHG NHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGL GLPSFKPGFAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQ VRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALAKPPSP CAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASVLAVSQQEYLDSMKKN KVHRDPPPDKS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_060072 |
RefSeq Size | 2759 |
RefSeq ORF | 1713 |
Synonyms | DUBA |
Locus ID | 55593 |
UniProt ID | Q96G74, A0A024QZ09 |
Cytogenetics | Xp11.23 |
Summary | This gene encodes a member of the OTU (ovarian tumor) domain-containing cysteine protease superfamily. The OTU domain confers deubiquitinase activity and the encoded protein has been shown to suppress the type I interferon-dependent innate immune response by cleaving the polyubiquitin chain from an essential type I interferon adaptor protein. Cleavage results in disassociation of the adaptor protein from a downstream signaling complex and disruption of the type I interferon signaling cascade. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Oct 2008] |
Protein Families | Protease |
Protein Pathways | RIG-I-like receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413689 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC427830 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC427831 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC427832 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY413689 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 1 |
USD 325.00 |
|
LY427830 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 2 |
USD 325.00 |
|
LY427831 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 3 |
USD 325.00 |
|
LY427832 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 4 |
USD 325.00 |
|
TP300893 | Recombinant protein of human OTU domain containing 5 (OTUD5), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review