CHAC1 (NM_024111) Human Mass Spec Standard

CAT#: PH300912

CHAC1 MS Standard C13 and N15-labeled recombinant protein (NP_077016)

Product Images

Coomassie blue staining of purified CHAC1 protein (Cat# TP300912). The protein was produced from HEK293T cells transfected with CHAC1 cDNA clone (Cat# RC200912) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200912
• Predicted MW: 24.4 kDa
• Protein Sequence:
  Sequence Link

  >RC200912 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTF
  HRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKA
  LAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLP
  CFCPTEQALALV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_077016
• RefSeq Size: 1578
• RefSeq ORF: 666
• Synonyms: MGC4504
• Locus ID: 79094
• UniProt ID: Q9BUX1
• Cytogenetics: 15q15.1
• Summary: This gene encodes a member of the gamma-glutamylcyclotransferase family of proteins. The encoded protein has been shown to promote neuronal differentiation by deglycination of the Notch receptor, which prevents receptor maturation and inhibits Notch signaling. This protein may also play a role in the unfolded protein response, and in regulation of glutathione levels and oxidative balance in the cell. Elevated expression of this gene may indicate increased risk of cancer recurrence among breast and ovarian cancer patients. [provided by RefSeq, Sep 2016]