NUDT21 (NM_007006) Human Mass Spec Standard

CAT#: PH300936

NUDT21 MS Standard C13 and N15-labeled recombinant protein (NP_008937)

Product Images

Coomassie blue staining of purified NUDT21 protein (Cat# TP300936). The protein was produced from HEK293T cells transfected with NUDT21 cDNA clone (Cat# RC200936) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200936
• Predicted MW: 26.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200936 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREE
  FDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWV
  IDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGP
  IISSLPQLLSRFNFIYN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008937
• RefSeq Size: 4407
• RefSeq ORF: 681
• Synonyms: CFIM25; CPSF5
• Locus ID: 11051
• UniProt ID: O43809, A0A024R6W2
• Cytogenetics: 16q13
• Summary: The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. [provided by RefSeq, Jul 2008]