PDXK (NM_003681) Human Mass Spec Standard

CAT#: PH300975

PDXK MS Standard C13 and N15-labeled recombinant protein (NP_003672)

Product Images

Coomassie blue staining of purified PDXK protein (Cat# TP300975). The protein was produced from HEK293T cells transfected with PDXK cDNA clone (Cat# RC200975) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200975
• Predicted MW: 35.1 kDa
• Protein Sequence:
  Sequence Link

  >RC200975 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLR
  LNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKV
  VPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNP
  AGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGE
  GVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003672
• RefSeq Size: 7390
• RefSeq ORF: 936
• Synonyms: C21orf97; C21orf124; HEL-S-1a; PKH; PNK; PRED79
• Locus ID: 8566
• UniProt ID: O00764, V9HWC3
• Cytogenetics: 21q22.3
• Summary: The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Vitamin B6 metabolism