HIST3H2A (NM_033445) Human Mass Spec Standard
CAT#: PH300984
HIST3H2A MS Standard C13 and N15-labeled recombinant protein (NP_254280)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200984 |
Predicted MW | 13.9 kDa |
Protein Sequence |
>RC200984 representing NM_033445
Red=Cloning site Green=Tags(s) MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNA ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_254280 |
RefSeq Size | 496 |
RefSeq ORF | 390 |
Synonyms | MGC3165 |
Locus ID | 92815 |
UniProt ID | Q7L7L0 |
Cytogenetics | 1q42.13 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq, Aug 2015] |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409510 | HIST3H2A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY409510 | Transient overexpression lysate of histone cluster 3, H2a (HIST3H2A) |
USD 325.00 |
|
TP300984 | Recombinant protein of human histone cluster 3, H2a (HIST3H2A) |
USD 823.00 |
|
TP710343 | Purified recombinant protein of Human histone cluster 3, H2a (HIST3H2A), full length, with with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review