NSFL1C (NM_016143) Human Mass Spec Standard

CAT#: PH301022

NSFL1C MS Standard C13 and N15-labeled recombinant protein (NP_057227)

Product Images

Coomassie blue staining of purified NSFL1C protein (Cat# TP301022). The protein was produced from HEK293T cells transfected with NSFL1C cDNA clone (Cat# RC201022) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201022
• Predicted MW: 40.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201022 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRGTAPSDN
  RVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKS
  PGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDVHVVLKLWKSGFSLDNGELRSYQDPSNAQFL
  ESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENE
  AKASSSILIDESEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELAD
  ESQTLKEANLLNAVIVQRLT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057227
• RefSeq Size: 3568
• RefSeq ORF: 1110
• Synonyms: dJ776F14.1; P47; UBX1; UBXD10; UBXN2C
• Locus ID: 55968
• UniProt ID: Q9UNZ2, Q53FE8
• Cytogenetics: 20p13
• Summary: N-ethylmaleimide-sensitive factor (NSF) and valosin-containing protein (p97) are two ATPases known to be involved in transport vesicle/target membrane fusion and fusions between membrane compartments. A trimer of the protein encoded by this gene binds a hexamer of cytosolic p97 and is required for p97-mediated regrowth of Golgi cisternae from mitotic Golgi fragments. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 8. [provided by RefSeq, May 2011]