CENPM (NM_024053) Human Mass Spec Standard

CAT#: PH301047

CENPM MS Standard C13 and N15-labeled recombinant protein (NP_076958)

Product Images

Coomassie blue staining of purified CENPM protein (Cat# TP301047). The protein was produced from HEK293T cells transfected with CENPM cDNA clone (Cat# RC201047) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201047
• Predicted MW: 19.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201047 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCASELKVHLAKSLPLPSSVNRPRIDLIVFVV
  NLHSKYSLQNTEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEGFRA
  TMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSLEDL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_076958
• RefSeq Size: 947
• RefSeq ORF: 540
• Synonyms: C22orf18; CENP-M; PANE1
• Locus ID: 79019
• UniProt ID: Q9NSP4, A0A024R1Q3
• Cytogenetics: 22q13.2
• Summary: The protein encoded by this gene is an inner protein of the kinetochore, the multi-protein complex that binds spindle microtubules to regulate chromosome segregation during cell division. It belongs to the constitutive centromere-associated network protein group, whose members interact with outer kinetochore proteins and help to maintain centromere identity at each cell division cycle. The protein is structurally related to GTPases but cannot bind guanosine triphosphate. A point mutation that affects interaction with another constitutive centromere-associated network protein, CENP-I, impairs kinetochore assembly and chromosome alignment, suggesting that it is required for kinetochore formation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]
• Protein Families: Druggable Genome