Acid Phosphatase (ACP1) (NM_007099) Human Mass Spec Standard

CAT#: PH301078

ACP1 MS Standard C13 and N15-labeled recombinant protein (NP_009030)

Product Images

Coomassie blue staining of purified ACP1 protein (Cat# TP301078). The protein was produced from HEK293T cells transfected with ACP1 cDNA clone (Cat# RC201078) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201078
• Predicted MW: 18 kDa
• Protein Sequence:
  Sequence Link

  >RC201078 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIH
  TAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFE
  TVYQQCVRCCRAFLEKAH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009030
• RefSeq Size: 1568
• RefSeq ORF: 474
• Synonyms: HAAP; LMW-PTP; LMWPTP
• Locus ID: 52
• UniProt ID: P24666
• Cytogenetics: 2p25.3
• Summary: 'The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2008]'
• Protein Families: Druggable Genome, Phosphatase, Transmembrane
• Protein Pathways: Adherens junction, Riboflavin metabolism