PPIC (NM_000943) Human Mass Spec Standard

CAT#: PH301143

PPIC MS Standard C13 and N15-labeled recombinant protein (NP_000934)

Product Images

Coomassie blue staining of purified PPIC protein (Cat# TP301143). The protein was produced from HEK293T cells transfected with PPIC cDNA clone (Cat# RC201143) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201143
• Predicted MW: 22.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201143 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENF
  VALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPD
  TNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIA
  DW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000934
• RefSeq Size: 1241
• RefSeq ORF: 636
• Synonyms: CYPC
• Locus ID: 5480
• UniProt ID: P45877
• Cytogenetics: 5q23.2
• Summary: 'The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase)) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. Similar to other PPIases, this protein can bind immunosuppressant cyclosporin A. [provided by RefSeq, Jul 2008]'
• Protein Families: Transmembrane