MNK1 (MKNK1) (NM_003684) Human Mass Spec Standard

CAT#: PH301149

MKNK1 MS Standard C13 and N15-labeled recombinant protein (NP_003675)

Product Images

Coomassie blue staining of purified MKNK1 protein (Cat# TP301149). The protein was produced from HEK293T cells transfected with MKNK1 cDNA clone (Cat# RC201149) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201149
• Predicted MW: 51.3 kDa
• Protein Sequence:
  Sequence Link

  >RC201149 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQ
  NGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQK
  HFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHR
  DLKPENILCESPEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDK
  RCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDL
  ISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL
  AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003675
• RefSeq Size: 2827
• RefSeq ORF: 1395
• Synonyms: MNK1
• Locus ID: 8569
• UniProt ID: Q9BUB5
• Cytogenetics: 1p33
• Summary: This gene encodes a Ser/Thr protein kinase that interacts with, and is activated by ERK1 and p38 mitogen-activated protein kinases, and thus may play a role in the response to environmental stress and cytokines. This kinase may also regulate transcription by phosphorylating eIF4E via interaction with the C-terminal region of eIF4G. Alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Jan 2012]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Insulin signaling pathway, MAPK signaling pathway