UQCRH (NM_006004) Human Mass Spec Standard

CAT#: PH301258

UQCRH MS Standard C13 and N15-labeled recombinant protein (NP_005995)

Product Images

Coomassie blue staining of purified UQCRH protein (Cat# TP301258). The protein was produced from HEK293T cells transfected with UQCRH cDNA clone (Cat# RC201258) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201258
• Predicted MW: 10.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201258 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEE
  LFDFLHARDHCVAHKLFNNLK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005995
• RefSeq Size: 623
• RefSeq ORF: 273
• Synonyms: QCR6; UQCR8
• Locus ID: 7388
• UniProt ID: P07919
• Cytogenetics: 1p33
• Summary: ''
• Protein Families: Druggable Genome
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease