CXorf56 (NM_022101) Human Mass Spec Standard

CAT#: PH301305

CXorf56 MS Standard C13 and N15-labeled recombinant protein (NP_071384)

Product Images

Coomassie blue staining of purified CXorf56 protein (Cat# TP301305). The protein was produced from HEK293T cells transfected with CXorf56 cDNA clone (Cat# RC201305) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201305
• Predicted MW: 25.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201305 representing NM_022101
  Red=Cloning site Green=Tags(s)
  
  MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHAHKFCN
  TEDEETMYLRRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFGKTNIYTQKQEPPK
  KVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKA
  KMKGTLIDNQFK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071384
• RefSeq Size: 904
• RefSeq ORF: 666
• Synonyms: MRX107
• Locus ID: 63932
• UniProt ID: Q9H5V9
• Cytogenetics: Xq24
• Summary: While this gene is well-supported by transcript data, no functional information on its protein products is currently available. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]