FOXS1 (NM_004118) Human Mass Spec Standard

CAT#: PH301400

FOXS1 MS Standard C13 and N15-labeled recombinant protein (NP_004109)

Product Images

Coomassie blue staining of purified FOXS1 protein (Cat# TP301400). The protein was produced from HEK293T cells transfected with FOXS1 cDNA clone (Cat# RC201400) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201400
• Predicted MW: 35.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201400 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNL
  SLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQD
  PGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVAT
  SSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPT
  PPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004109
• RefSeq Size: 1353
• RefSeq ORF: 990
• Synonyms: FKHL18; FREAC10
• Locus ID: 2307
• UniProt ID: O43638
• Cytogenetics: 20q11.21
• Summary: 'The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown. [provided by RefSeq, Jul 2008]'
• Protein Families: Transcription Factors