H2AFX (Histone H2A.X (H2AFX)) (NM_002105) Mass Spec Standard

CAT#: PH301434

H2AFX MS Standard C13 and N15-labeled recombinant protein (NP_002096)

Specifications

Product Data

• Tag: C-Myc/DDK
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201434
• Predicted MW: 15.1 kDa
• Protein Sequence:
  Sequence Link

  >RC201434 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNA
  ARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQAS
  QEY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: > 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002096
• RefSeq Size: 1651
• RefSeq ORF: 429
• Synonyms: H2A.X; H2A/X; H2AX
• Locus ID: 3014
• UniProt ID: P16104
• Cytogenetics: 11q23.3
• Summary: 'Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-independent histone that is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. [provided by RefSeq, Oct 2015]'
• Protein Families: Druggable Genome
• Protein Pathways: Systemic lupus erythematosus