SDHAF2 (NM_017841) Human Mass Spec Standard

CAT#: PH301437

SDHAF2 MS Standard C13 and N15-labeled recombinant protein (NP_060311)

Product Images

Coomassie blue staining of purified SDHAF2 protein (Cat# TP301437). The protein was produced from HEK293T cells transfected with SDHAF2 cDNA clone (Cat# RC201437) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201437
• Predicted MW: 19.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201437 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARL
  LYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVMALL
  RDFAKNKNKEQRLRAPDLEYLFEKPR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060311
• RefSeq Size: 1227
• RefSeq ORF: 498
• Synonyms: C11orf79; PGL2; SDH5
• Locus ID: 54949
• UniProt ID: Q9NX18
• Cytogenetics: 11q12.2
• Summary: This gene encodes a mitochondrial protein needed for the flavination of a succinate dehydrogenase complex subunit required for activity of the complex. Mutations in this gene are associated with paraganglioma. [provided by RefSeq, Jul 2010]