VPS29 (NM_057180) Human Mass Spec Standard
CAT#: PH301460
VPS29 MS Standard C13 and N15-labeled recombinant protein (NP_476528)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201460 |
Predicted MW | 20.9 kDa |
Protein Sequence |
>RC201460 protein sequence
Red=Cloning site Green=Tags(s) MAGHRLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDEN LNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSAT GAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_476528 |
RefSeq Size | 1153 |
RefSeq ORF | 558 |
Synonyms | DC7; DC15; PEP11 |
Locus ID | 51699 |
UniProt ID | Q9UBQ0, A0A384MR19 |
Cytogenetics | 12q24.11 |
Summary | This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retromer complex, which is involved in retrograde transport of proteins from endosomes to the trans-Golgi network. This VPS protein may be involved in the formation of the inner shell of the retromer coat for retrograde vesicles leaving the prevacuolar compartment. Alternative splice variants encoding different isoforms and representing non-protein coding transcripts have been found for this gene. [provided by RefSeq, Aug 2013] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409254 | VPS29 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC414109 | VPS29 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY409254 | Transient overexpression lysate of vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 2 |
USD 325.00 |
|
LY414109 | Transient overexpression lysate of vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1 |
USD 325.00 |
|
PH319311 | VPS29 MS Standard C13 and N15-labeled recombinant protein (NP_057310) |
USD 2,055.00 |
|
TP301460 | Recombinant protein of human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 2 |
USD 823.00 |
|
TP319311 | Recombinant protein of human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review