OCIAD1 (NM_017830) Human Mass Spec Standard
CAT#: PH301506
OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_060300)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201506 |
Predicted MW | 27.6 kDa |
Protein Sequence |
>RC201506 protein sequence
Red=Cloning site Green=Tags(s) MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSH PKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSG QSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESY EVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_060300 |
RefSeq Size | 2005 |
RefSeq ORF | 735 |
Synonyms | ASRIJ; OCIA; TPA018 |
Locus ID | 54940 |
UniProt ID | Q9NX40, A0A024R9U3 |
Cytogenetics | 4p11 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402620 | OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421553 | OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421556 | OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425897 | OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402620 | Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 1 |
USD 396.00 |
|
LY421553 | Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 2 |
USD 396.00 |
|
LY421556 | Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 5 |
USD 396.00 |
|
LY425897 | Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 5 |
USD 396.00 |
|
PH320792 | OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_001073311) |
USD 2,055.00 |
|
TP301506 | Recombinant protein of human OCIA domain containing 1 (OCIAD1), transcript variant 1 |
USD 823.00 |
|
TP320792 | Purified recombinant protein of Homo sapiens OCIA domain containing 1 (OCIAD1), transcript variant 5 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review