NXT1 (NM_013248) Human Mass Spec Standard

CAT#: PH301510

NXT1 MS Standard C13 and N15-labeled recombinant protein (NP_037380)

Product Images

Coomassie blue staining of purified NXT1 protein (Cat# TP301510). The protein was produced from HEK293T cells transfected with NXT1 cDNA clone (Cat# RC201510) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201510
• Predicted MW: 15.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201510 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEF
  QISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037380
• RefSeq Size: 1176
• RefSeq ORF: 420
• Synonyms: MTR2; P15
• Locus ID: 29107
• UniProt ID: Q9UKK6
• Cytogenetics: 20p11.21
• Summary: The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. The encoded protein heterodimerizes with Tap protein and may regulate the ability of Tap protein to mediate nuclear mRNA export. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]