SCAMP3 (NM_005698) Human Mass Spec Standard

CAT#: PH301633

SCAMP3 MS Standard C13 and N15-labeled recombinant protein (NP_005689)

Product Images

Coomassie blue staining of purified SCAMP3 protein (Cat# TP301633). The protein was produced from HEK293T cells transfected with SCAMP3 cDNA clone (Cat# RC201633) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201633
• Predicted MW: 38.3 kDa
• Protein Sequence:
  Sequence Link

  >RC201633 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQ
  PSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPS
  FCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETNNGAGFGLSILWVLLFT
  PCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLML
  LVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005689
• RefSeq Size: 1595
• RefSeq ORF: 1041
• Synonyms: C1orf3
• Locus ID: 10067
• UniProt ID: O14828
• Cytogenetics: 1q22
• Summary: This gene encodes an integral membrane protein that belongs to the secretory carrier membrane protein family. The encoded protein functions as a carrier to the cell surface in post-golgi recycling pathways. This protein is also involved in protein trafficking in endosomal pathways. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]
• Protein Families: Transmembrane