Spermidine synthase (SRM) (NM_003132) Human Mass Spec Standard

CAT#: PH301761

SRM MS Standard C13 and N15-labeled recombinant protein (NP_003123)

Product Images

Coomassie blue staining of purified SRM protein (Cat# TP301761). The protein was produced from HEK293T cells transfected with SRM cDNA clone (Cat# RC201761) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201761
• Predicted MW: 33.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201761 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQ
  CTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGM
  AIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQ
  WLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYN
  SDVHRAAFVLPEFARKALNDVS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003123
• RefSeq Size: 1273
• RefSeq ORF: 906
• Synonyms: PAPT; SPDSY; SPS1; SRML1
• Locus ID: 6723
• UniProt ID: P19623
• Cytogenetics: 1p36.22
• Summary: The polyamines putrescine, spermine, and spermidine are ubiquitous polycationic mediators of cell growth and differentiation. Spermidine synthase is one of four enzymes in the polyamine-biosynthetic pathway and carries out the final step of spermidine biosynthesis. This enzyme catalyzes the conversion of putrescine to spermidine using decarboxylated S-adenosylmethionine as the cofactor. [provided by RefSeq, Jul 2008]
• Protein Pathways: Arginine and proline metabolism, beta-Alanine metabolism, Cysteine and methionine metabolism, Glutathione metabolism, Metabolic pathways