AHA1 (AHSA1) (NM_012111) Human Mass Spec Standard

CAT#: PH301782

AHSA1 MS Standard C13 and N15-labeled recombinant protein (NP_036243)

Product Images

Coomassie blue staining of purified AHSA1 protein (Cat# TP301782). The protein was produced from HEK293T cells transfected with AHSA1 cDNA clone (Cat# RC201782) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201782
• Predicted MW: 38.3 kDa
• Protein Sequence:
  Sequence Link

  >RC201782 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASI
  NNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTNLVALMKEEG
  VKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKIT
  LKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWP
  EGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036243
• RefSeq Size: 1429
• RefSeq ORF: 1014
• Synonyms: AHA1; C14orf3; hAha1; p38
• Locus ID: 10598
• UniProt ID: O95433
• Cytogenetics: 14q24.3
• Summary: Acts as a co-chaperone of HSP90AA1. Activates the ATPase activity of HSP90AA1 leading to increase in its chaperone activity. Competes with the inhibitory co-chaperone FNIP1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PubMed:27353360). [UniProtKB/Swiss-Prot Function]