U1A (SNRPA) (NM_004596) Human Mass Spec Standard

CAT#: PH301818

SNRPA MS Standard C13 and N15-labeled recombinant protein (NP_004587)

Product Images

Coomassie blue staining of purified SNRPA protein (Cat# TP301818). The protein was produced from HEK293T cells transfected with SNRPA cDNA clone (Cat# RC201818) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201818
• Predicted MW: 31.3 kDa
• Protein Sequence:
  Sequence Link

  >RC201818 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALR
  SMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGP
  VPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHIL
  FLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFA
  KK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004587
• RefSeq Size: 1646
• RefSeq ORF: 846
• Synonyms: Mud1; U1-A; U1A
• Locus ID: 6626
• UniProt ID: P09012
• Cytogenetics: 19q13.2
• Summary: 'The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation. [provided by RefSeq, Oct 2010]'
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Spliceosome