HMG20A (NM_018200) Human Mass Spec Standard

CAT#: PH301894

HMG20A MS Standard C13 and N15-labeled recombinant protein (NP_060670)

Product Images

Coomassie blue staining of purified HMG20A protein (Cat# TP301894). The protein was produced from HEK293T cells transfected with HMG20A cDNA clone (Cat# RC201894) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201894
• Predicted MW: 40.1 kDa
• Protein Sequence:
  Sequence Link

  >RC201894 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEFVEDLSQGQLLQSESSNAAE
  GNEQRHEDEQRSKRGGWSKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQLRAKRPEVPFPEITRMLGNE
  WSKLPPEEKQRYLDEADRDKERYMKELEQYQKTEAYKVFSRKTQDRQKGKSHRQDAARQATHDHEKETEV
  KERSVFDIPIFTEEFLNHSKAREAELRQLRKSNMEFEERNAALQKHVESMRTAVEKLEVDVIQERSRNTV
  LQQHLETLRQVLTSSFASMPLPGSGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060670
• RefSeq Size: 3898
• RefSeq ORF: 1041
• Synonyms: HMGX1; HMGXB1
• Locus ID: 10363
• UniProt ID: Q9NP66
• Cytogenetics: 15q24.3
• Summary: Plays a role in neuronal differentiation as chromatin-associated protein. Acts as inhibitor of HMG20B. Overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. Involved in the recruitment of the histone methyltransferase KMT2A/MLL1 and consequent increased methylation of histone H3 lysine 4. [UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors