PPM1A (NM_021003) Human Mass Spec Standard

CAT#: PH302070

PPM1A MS Standard C13 and N15-labeled recombinant protein (NP_066283)

Product Images

Coomassie blue staining of purified PPM1A protein (Cat# TP302070). The protein was produced from HEK293T cells transfected with PPM1A cDNA clone (Cat# RC202070) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202070
• Predicted MW: 42.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202070 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKY
  CCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTY
  FINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGP
  TEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGS
  RDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGE
  LASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066283
• RefSeq Size: 8210
• RefSeq ORF: 1146
• Synonyms: PP2C-ALPHA; PP2CA; PP2Calpha
• Locus ID: 5494
• UniProt ID: P35813, A0A024R6A5
• Cytogenetics: 14q23.1
• Summary: 'The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the activities of, MAP kinases and MAP kinase kinases. It has been shown to inhibit the activation of p38 and JNK kinase cascades induced by environmental stresses. This phosphatase can also dephosphorylate cyclin-dependent kinases, and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to activate the expression of the tumor suppressor gene TP53/p53, which leads to G2/M cell cycle arrest and apoptosis. Three alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: MAPK signaling pathway