MTHFD2 (NM_006636) Human Mass Spec Standard

CAT#: PH302143

MTHFD2 MS Standard C13 and N15-labeled recombinant protein (NP_006627)

Product Images

Coomassie blue staining of purified MTHFD2 protein (Cat# TP302143). The protein was produced from HEK293T cells transfected with MTHFD2 cDNA clone (Cat# RC202143) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202143
• Predicted MW: 37.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202143 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAATSLMSALAARLLQPAHSCSLRLRPFHLAAVRNEAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHL
  SVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHID
  ERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIA
  MLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVH
  DPVTAKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEREVLKSKELGVATN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006627
• RefSeq Size: 2208
• RefSeq ORF: 1050
• Synonyms: NMDMC
• Locus ID: 10797
• UniProt ID: P13995
• Cytogenetics: 2p13.1
• Summary: This gene encodes a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD. Alternative splicing results in two different transcripts, one protein-coding and the other not protein-coding. This gene has a pseudogene on chromosome 7. [provided by RefSeq, Mar 2009]
• Protein Families: Druggable Genome
• Protein Pathways: Glyoxylate and dicarboxylate metabolism, Metabolic pathways, One carbon pool by folate