FKBPL (NM_022110) Human Mass Spec Standard

CAT#: PH302153

FKBPL MS Standard C13 and N15-labeled recombinant protein (NP_071393)

Product Images

Coomassie blue staining of purified FKBPL protein (Cat# TP302153). The protein was produced from HEK293T cells transfected with FKBPL cDNA clone (Cat# RC202153) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202153
• Predicted MW: 38.2 kDa
• Protein Sequence:
  Sequence Link

  >RC202153 protein sequence
  Red=Cloning site Green=Tags(s)
  
  METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLV
  AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEG
  WTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALA
  REERARGTELFRAGNPEGAARCYGRALRLLLTLPPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLE
  REPGHLKALYRRGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQGLRKMFG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071393
• RefSeq Size: 1357
• RefSeq ORF: 1047
• Synonyms: DIR1; FKBP4; NG7; WISP39
• Locus ID: 63943
• UniProt ID: Q9UIM3, A0A024RCQ6
• Cytogenetics: 6p21.32
• Summary: The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The encoded protein is thought to have a potential role in the induced radioresistance. Also it appears to have some involvement in the control of the cell cycle. [provided by RefSeq, Jul 2008]