GNG11 (NM_004126) Human Mass Spec Standard

CAT#: PH302169

GNG11 MS Standard C13 and N15-labeled recombinant protein (NP_004117)

Product Images

Coomassie blue staining of purified GNG11 protein (Cat# TP302169). The protein was produced from HEK293T cells transfected with GNG11 cDNA clone (Cat# RC202169) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202169
• Predicted MW: 8.5 kDa
• Protein Sequence:
  Sequence Link

  >RC202169 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSC
  VIS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004117
• RefSeq Size: 964
• RefSeq ORF: 219
• Synonyms: GNGT11
• Locus ID: 2791
• UniProt ID: P61952, Q53Y01
• Cytogenetics: 7q21.3
• Summary: This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway