PSMD6 (NM_014814) Human Mass Spec Standard

CAT#: PH302292

PSMD6 MS Standard C13 and N15-labeled recombinant protein (NP_055629)

Product Images

Coomassie blue staining of purified PSMD6 protein (Cat# TP302292). The protein was produced from HEK293T cells transfected with PSMD6 cDNA clone (Cat# RC202292) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202292
• Predicted MW: 45.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202292 representing NM_014814
  Red=Cloning site Green=Tags(s)
  
  MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLL
  NKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDI
  VFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTS
  YELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQ
  EMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKV
  NEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055629
• RefSeq Size: 1308
• RefSeq ORF: 1167
• Synonyms: p42A; p44S10; Rpn7; S10; SGA-113M
• Locus ID: 9861
• UniProt ID: Q15008
• Cytogenetics: 3p14.1
• Summary: This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing results in multiple transcript variants [provided by RefSeq, Nov 2012]
• Protein Pathways: Proteasome