SLBP (NM_006527) Human Mass Spec Standard

CAT#: PH302361

SLBP MS Standard C13 and N15-labeled recombinant protein (NP_006518)

Product Images

Coomassie blue staining of purified SLBP protein (Cat# TP302361). The protein was produced from HEK293T cells transfected with SLBP cDNA clone (Cat# RC202361) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202361
• Predicted MW: 31.3 kDa
• Protein Sequence:
  Sequence Link

  >RC202361 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MACRPRSPPRHQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEAEHRGAERRPESFTTPEGPKPRS
  RCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQK
  QINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEI
  HPVDLESAESSSEPQTSSQDDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAMS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006518
• RefSeq Size: 1743
• RefSeq ORF: 810
• Synonyms: HBP
• Locus ID: 7884
• UniProt ID: Q14493, Q53XR2, B3KSC5, B3KST9
• Cytogenetics: 4p16.3
• Summary: This gene encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1. [provided by RefSeq, Jul 2008]