ARFGAP3 (NM_014570) Human Mass Spec Standard
CAT#: PH302392
ARFGAP3 MS Standard C13 and N15-labeled recombinant protein (NP_055385)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202392 |
Predicted MW | 57 kDa |
Protein Sequence |
>RC202392 protein sequence
Red=Cloning site Green=Tags(s) MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTELDSN WSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVP PLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPVETTLENNEGGQEQGPSVEGLNVPTKATLEV SSIIKKKPNQAKKGLGAKKGSLGAQKLANTCFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYK DLEIQMKKDEKMNISGKKNVDSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYF TSSSRYFDEPVELRSSSFSSWDDSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKK FGNVKAISSDMYFGRQSQADYETRARLERLSASSSISSADLFEEPRKQPAGNYSLSSVLPNAPDMAQFKQ GVRSVAGKLSVFANGVVTSIQDRYGS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055385 |
RefSeq Size | 2851 |
RefSeq ORF | 1548 |
Synonyms | ARFGAP1 |
Locus ID | 26286 |
UniProt ID | Q9NP61, A0A024R4U0 |
Cytogenetics | 22q13.2 |
Summary | The protein encoded by this gene is a GTPase-activating protein (GAP) that associates with the Golgi apparatus and regulates the early secretory pathway of proteins. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1 (ARF1)-bound GTP, which is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is a prerequisite for the fusion of these vesicles with target compartments. The activity of this protein is sensitive to phospholipids. Multiple transcript variants encoding different isoforms have been found for this gene. This gene was originally known as ARFGAP1, but that is now the name of a related but different gene. [provided by RefSeq, Nov 2008] |
Protein Pathways | Endocytosis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415207 | ARFGAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415207 | Transient overexpression lysate of ADP-ribosylation factor GTPase activating protein 3 (ARFGAP3), transcript variant 1 |
USD 396.00 |
|
TP302392 | Recombinant protein of human ADP-ribosylation factor GTPase activating protein 3 (ARFGAP3), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review