PAG608 (ZMAT3) (NM_022470) Human Mass Spec Standard
CAT#: PH302508
ZMAT3 MS Standard C13 and N15-labeled recombinant protein (NP_071915)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202508 |
Predicted MW | 32.1 kDa |
Protein Sequence |
>RC202508 protein sequence
Red=Cloning site Green=Tags(s) MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKPL YCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPAATPVVPVPPQMGSFKPGGRV ILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEAQSNSFSESSELGQRRARKEGNEFKMMPNRR NMYTVQNNSAGPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYR NEMENLGYV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_071915 |
RefSeq Size | 8995 |
RefSeq ORF | 867 |
Synonyms | PAG608; WIG-1; WIG1 |
Locus ID | 64393 |
UniProt ID | Q9HA38 |
Cytogenetics | 3q26.32 |
Summary | This gene encodes a protein containing three zinc finger domains and a nuclear localization signal. The mRNA and the protein of this gene are upregulated by wildtype p53 and overexpression of this gene inhibits tumor cell growth, suggesting that this gene may have a role in the p53-dependent growth regulatory pathway. Alternative splicing of this gene results in two transcript variants encoding two isoforms differing in only one amino acid. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | p53 signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403457 | ZMAT3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC411657 | ZMAT3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403457 | Transient overexpression lysate of zinc finger, matrin type 3 (ZMAT3), transcript variant 2 |
USD 396.00 |
|
LY411657 | Transient overexpression lysate of zinc finger, matrin type 3 (ZMAT3), transcript variant 1 |
USD 396.00 |
|
TP302508 | Recombinant protein of human zinc finger, matrin type 3 (ZMAT3), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review