Rab4 (RAB4A) (NM_004578) Human Mass Spec Standard

CAT#: PH302572

RAB4A MS Standard C13 and N15-labeled recombinant protein (NP_004569)

Product Images

Coomassie blue staining of purified RAB4A protein (Cat# TP302572). The protein was produced from HEK293T cells transfected with RAB4A cDNA clone (Cat# RC202572) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202572
• Predicted MW: 24.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202572 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTA
  GQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE
  ASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQA
  PNAQECGC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004569
• RefSeq Size: 3056
• RefSeq ORF: 654
• Synonyms: HRES-1; HRES-1/RAB4; HRES1; RAB4
• Locus ID: 5867
• UniProt ID: P20338, A0A024R3U9
• Cytogenetics: 1q42.13
• Summary: 'This gene is a member of the largest group in the Ras superfamily of small GTPases, which regulate membrane trafficking. The encoded protein is associated with early endosomes and is involved in their sorting and recycling. The protein also plays a role in regulating the recycling of receptors from endosomes to the plasma membrane. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012]'
• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis