C1orf41 (HSPB11) (NM_016126) Human Mass Spec Standard
CAT#: PH302693
HSPB11 MS Standard C13 and N15-labeled recombinant protein (NP_057210)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202693 |
Predicted MW | 16.3 kDa |
Protein Sequence |
>RC202693 protein sequence
Red=Cloning site Green=Tags(s) MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQ TLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVS NLSS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057210 |
RefSeq Size | 601 |
RefSeq ORF | 432 |
Synonyms | C1orf41; HSPCO34; IFT25; PP25 |
Locus ID | 51668 |
UniProt ID | Q9Y547 |
Cytogenetics | 1p32.3 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414172 | HSPB11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414172 | Transient overexpression lysate of heat shock protein family B (small), member 11 (HSPB11) |
USD 396.00 |
|
TP302693 | Recombinant protein of human heat shock protein family B (small), member 11 (HSPB11) |
USD 823.00 |
|
TP720224 | Recombinant protein of human heat shock protein family B (small), member 11 (HSPB11) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review