NDUFS4 (NM_002495) Human Mass Spec Standard

CAT#: PH302713

NDUFS4 MS Standard C13 and N15-labeled recombinant protein (NP_002486)

Product Images

Coomassie blue staining of purified NDUFS4 protein (Cat# TP302713). The protein was produced from HEK293T cells transfected with NDUFS4 cDNA clone (Cat# RC202713) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202713
• Predicted MW: 20.1 kDa
• Protein Sequence:
  Sequence Link

  >RC202713 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSSWRLAQDQTQDTQLITVDEKLDITTLTGVPEE
  HIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEK
  NGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002486
• RefSeq Size: 676
• RefSeq ORF: 525
• Synonyms: AQDQ; CI-18; CI-18 kDa; CI-AQDQ; MC1DN1
• Locus ID: 4724
• UniProt ID: O43181, A0A0S2Z433
• Cytogenetics: 5q11.2
• Summary: 'This gene encodes an nuclear-encoded accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I, or NADH:ubiquinone oxidoreductase). Complex I removes electrons from NADH and passes them to the electron acceptor ubiquinone. Mutations in this gene can cause mitochondrial complex I deficiencies such as Leigh syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]'
• Protein Families: Druggable Genome
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease