FABP3 (NM_004102) Human Mass Spec Standard

CAT#: PH302737

FABP3 MS Standard C13 and N15-labeled recombinant protein (NP_004093)

Product Images

Coomassie blue staining of purified FABP3 protein (Cat# TP302737). The protein was produced from HEK293T cells transfected with FABP3 cDNA clone (Cat# RC202737) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202737
• Predicted MW: 14.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202737 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVE
  FDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004093
• RefSeq Size: 1097
• RefSeq ORF: 399
• Synonyms: FABP11; H-FABP; M-FABP; MDGI; O-FABP
• Locus ID: 2170
• UniProt ID: P05413, A0A384MDY5
• Cytogenetics: 1p35.2
• Summary: 'The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]'
• Protein Pathways: PPAR signaling pathway