DNAL1 (NM_031427) Human Mass Spec Standard
CAT#: PH302768
DNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_113615)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202768 |
Predicted MW | 17.1 kDa |
Protein Sequence |
>RC202768 protein sequence
Red=Cloning site Green=Tags(s) MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLK GIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGT PVIKGDEEEDN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_113615 |
RefSeq Size | 8538 |
RefSeq ORF | 453 |
Synonyms | C14orf168; CILD16; LC1 |
Locus ID | 83544 |
UniProt ID | Q4LDG9 |
Cytogenetics | 14q24.3 |
Summary | This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2011] |
Protein Pathways | Huntington's disease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410537 | DNAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410537 | Transient overexpression lysate of dynein, axonemal, light chain 1 (DNAL1) |
USD 396.00 |
|
TP302768 | Recombinant protein of human dynein, axonemal, light chain 1 (DNAL1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review