Centrin 3 (CETN3) (NM_004365) Human Mass Spec Standard

CAT#: PH302804

CETN3 MS Standard C13 and N15-labeled recombinant protein (NP_004356)

Product Images

Coomassie blue staining of purified CETN3 protein (Cat# TP302804). The protein was produced from HEK293T cells transfected with CETN3 cDNA clone (Cat# RC202804) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202804
• Predicted MW: 19.6 kDa
• Protein Sequence:
  Sequence Link

  >RC202804 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKIL
  KDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELR
  AMIEEFDKDGDGEINQEEFIAIMTGDI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004356
• RefSeq Size: 1374
• RefSeq ORF: 501
• Synonyms: CDC31; CEN3
• Locus ID: 1070
• UniProt ID: O15182
• Cytogenetics: 5q14.3
• Summary: 'The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]'
• Protein Families: Druggable Genome