RAB14 (NM_016322) Human Mass Spec Standard

CAT#: PH302832

RAB14 MS Standard C13 and N15-labeled recombinant protein (NP_057406)

Product Images

Coomassie blue staining of purified RAB14 protein (Cat# TP302832). The protein was produced from HEK293T cells transfected with RAB14 cDNA clone (Cat# RC202832) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202832
• Predicted MW: 23.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202832 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQ
  ERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK
  QFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR
  EGCGC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057406
• RefSeq Size: 4379
• RefSeq ORF: 645
• Synonyms: FBP; RAB-14
• Locus ID: 51552
• UniProt ID: P61106, A0A024R845
• Cytogenetics: 9q33.2
• Summary: RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]). [supplied by OMIM, Mar 2009]
• Protein Families: Druggable Genome