PHAP1 (ANP32A) (NM_006305) Human Mass Spec Standard

CAT#: PH302868

ANP32A MS Standard C13 and N15-labeled recombinant protein (NP_006296)

Product Images

Coomassie blue staining of purified ANP32A protein (Cat# TP302868). The protein was produced from HEK293T cells transfected with ANP32A cDNA clone (Cat# RC202868) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202868
• Predicted MW: 28.6 kDa
• Protein Sequence:
  Sequence Link

  >RC202868 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLE
  LSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLP
  QLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEED
  EEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006296
• RefSeq Size: 2479
• RefSeq ORF: 747
• Synonyms: C15orf1; HPPCn; I1PP2A; LANP; MAPM; PHAP1; PHAPI; PP32
• Locus ID: 8125
• UniProt ID: P39687, A0A384P5U2
• Cytogenetics: 15q23
• Protein Families: Druggable Genome, Stem cell - Pluripotency