ICAD (DFFA) (NM_004401) Human Mass Spec Standard
CAT#: PH302879
DFFA MS Standard C13 and N15-labeled recombinant protein (NP_004392)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202879 |
Predicted MW | 36.6 kDa |
Protein Sequence |
>RC202879 protein sequence
Red=Cloning site Green=Tags(s) MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIV DDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIIL LSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQE ESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIK KTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004392 |
RefSeq Size | 2053 |
RefSeq ORF | 993 |
Synonyms | DFF-45; DFF1; ICAD |
Locus ID | 1676 |
UniProt ID | O00273 |
Cytogenetics | 1p36.22 |
Summary | 'Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]' |
Protein Pathways | Apoptosis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418008 | DFFA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418008 | Transient overexpression lysate of DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1 |
USD 396.00 |
|
TP302879 | Recombinant protein of human DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1 |
USD 823.00 |
|
TP720857 | Purified recombinant protein of Human DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review