AP2S1 (NM_004069) Human Mass Spec Standard

CAT#: PH302919

AP2S1 MS Standard C13 and N15-labeled recombinant protein (NP_004060)

Product Images

Coomassie blue staining of purified AP2S1 protein (Cat# TP302919). The protein was produced from HEK293T cells transfected with AP2S1 cDNA clone (Cat# RC202919) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202919
• Predicted MW: 17 kDa
• Protein Sequence:
  Sequence Link

  >RC202919 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCIC
  VDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQS
  LE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004060
• RefSeq Size: 965
• RefSeq ORF: 426
• Synonyms: AP17; CLAPS2; FBH3; FBHOk; HHC3
• Locus ID: 1175
• UniProt ID: P53680
• Cytogenetics: 19q13.32
• Summary: 'One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]'
• Protein Pathways: Endocytosis, Huntington's disease