B3GAT3 (NM_012200) Human Mass Spec Standard
CAT#: PH303223
B3GAT3 MS Standard C13 and N15-labeled recombinant protein (NP_036332)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203223 |
Predicted MW | 36.9 kDa |
Protein Sequence |
>RC203223 representing NM_012200
Red=Cloning site Green=Tags(s) MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPE PEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAEGPTPLVSGLLAASGLLFTHLVVLTP KAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVYFADDDNTYSRELFEEMRWT RGVSVWPVGLVGGLRFEGPQVQDGRVVGFHTAWEPSRPFPVDMAGFAVALPLLLDKPNAQFDSTAPRGHL ESSLLSHLVDPKDLEPRAANCTRVLVWHTRTEKPKMKQEEQLQRQGRGSDPAIEV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036332 |
RefSeq Size | 1456 |
RefSeq ORF | 1005 |
Synonyms | GLCATI; glcUAT-I; JDSCD |
Locus ID | 26229 |
UniProt ID | O94766 |
Cytogenetics | 11q12.3 |
Summary | The protein encoded by this gene is a member of the glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product catalyzes the formation of the glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction in the final step of the biosynthesis of the linkage region of proteoglycans. A pseudogene of this gene has been identified on chromosome 3. [provided by RefSeq, Dec 2013] |
Protein Families | Transmembrane |
Protein Pathways | Chondroitin sulfate biosynthesis, Heparan sulfate biosynthesis, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402164 | B3GAT3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402164 | Transient overexpression lysate of beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I) (B3GAT3) |
USD 396.00 |
|
TP303223 | Recombinant protein of human beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I) (B3GAT3) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review