CAP2 (NM_006366) Human Mass Spec Standard

CAT#: PH303332

CAP2 MS Standard C13 and N15-labeled recombinant protein (NP_006357)

Product Images

Coomassie blue staining of purified CAP2 protein (Cat# TP303332). The protein was produced from HEK293T cells transfected with CAP2 cDNA clone (Cat# RC203332) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203332
• Predicted MW: 52.8 kDa
• Protein Sequence:
  Sequence Link

  >RC203332 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MANMQGLVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRILAGD
  VETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRGSNMFNHLSAVSESI
  PALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLRHVDWVKSYLNIWSELQAYIKEHHTTGLTWS
  KTGPVASTVSAFSVLSSGPGLPPPPPPLPPPGPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHV
  TDDQKTYKNPSLRAQGGQTQSPTKSHTPSPTSPKSYPSQKHAPVLELEGKKWRVEYQEDRNDLVISETEL
  KQVAYIFKCEKSTIQIKGKVNSIIIDNCKKLGLVFDNVVGIVEVINSQDIQIQVMGRVPTISINKTEGCH
  IYLSEDALDCEIVSAKSSEMNILIPQDGDYREFPIPEQFKTAWDGSKLITEPAEIMA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006357
• RefSeq Size: 3080
• RefSeq ORF: 1431
• Synonyms: 2810452G09Rik; adenylyl cyclase-associated protein 2; CAP, adenylate cyclase-associated protein, 2 (yeast); OTTHUMP00000039303
• Locus ID: 10486
• UniProt ID: P40123, Q5JPJ8
• Cytogenetics: 6p22.3
• Summary: This gene was identified by its similarity to the gene for human adenylyl cyclase-associated protein. The function of the protein encoded by this gene is unknown. However, the protein appears to be able to interact with adenylyl cyclase-associated protein and actin. [provided by RefSeq, Jul 2008]