DCUN1D1 (NM_020640) Human Mass Spec Standard

CAT#: PH303427

DCUN1D1 MS Standard C13 and N15-labeled recombinant protein (NP_065691)

Product Images

Coomassie blue staining of purified DCUN1D1 protein (Cat# TP303427). The protein was produced from HEK293T cells transfected with DCUN1D1 cDNA clone (Cat# RC203427) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203427
• Predicted MW: 30.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203427 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN
  RYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQ
  IPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPK
  DTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065691
• RefSeq Size: 3192
• RefSeq ORF: 777
• Synonyms: DCNL1; DCUN1L1; RP42; SCCRO; SCRO; Tes3
• Locus ID: 54165
• UniProt ID: Q96GG9, B4DM76
• Cytogenetics: 3q26.33
• Protein Families: Druggable Genome